PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28966.m000524
Common NameLOC8260453, RCOM_0363740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 733aa    MW: 79817.1 Da    PI: 6.5621
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28966.m000524genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.31.4e-32310367260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    +DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers+ +++++ei+Y+g Hnh+k
  28966.m000524 310 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSH-EGHITEIIYKGAHNHPK 367
                    7****************************************.***************85 PP

2WRKY102.82e-32524582159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Ct agC+v+k+ver+++d k v++tYeg+Hnh+
  28966.m000524 524 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCTVRKHVERASHDLKSVITTYEGKHNHD 582
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.433304368IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.0E-29306368IPR003657WRKY domain
SuperFamilySSF1182905.23E-26307368IPR003657WRKY domain
SMARTSM007741.1E-36309367IPR003657WRKY domain
PfamPF031062.9E-25310366IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.3E-37509584IPR003657WRKY domain
SuperFamilySSF1182901.96E-28516584IPR003657WRKY domain
PROSITE profilePS5081138.32519584IPR003657WRKY domain
SMARTSM007741.9E-37524583IPR003657WRKY domain
PfamPF031067.5E-25525582IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MAGIDDNVAI IGDWVPPTPS PRAFFSAILG DDRTEGLMLG PKEPGTARNT DKKDVTQTAG  60
AQFTELASFS EQKSSSRGGL VERMAARAGF NAPRLNTESI RSGDLSLNPE IRSPYLTIPP  120
GLSPTTLLDS PVFLSNSLAQ PSPTTGKFSF VPNANGNRSM LMSEPTDKSK DNFFEDINAS  180
SFAFKPVPDS GSSFFLGATN RITSVILLQQ SFPSIEVSVQ SKNFLQSHGI ESAKVQSENR  240
SNTLQFPVDF SRATTEKGDR ANSMRTERRV FDTVGGSAEH SPPLDEQQDE EGDQRASAEY  300
MAGSGGTPSE DGYNWRKYGQ KQVKGSEYPR SYYKCTHPNC PVKKKVERSH EGHITEIIYK  360
GAHNHPKPPP NRRSAIGSSN SIMDMQLDVP EQTGLQNGTE NDPVWASQQK GTATGTPDWR  420
HDNVEVTSSA SVGPEFGNHS SAVQALNGTN FESGDAIDAS STFSNDEDED DRATHGSVGY  480
DGEGDESESK RRKIETYPTD IAGATRAIRE PRVVVQTTSE VDILDDGYRW RKYGQKVVKG  540
NPNPRSYYKC TNAGCTVRKH VERASHDLKS VITTYEGKHN HDVPAARNSS HVNSGSSNTV  600
NTQGGTAGQT HVHRPEPAQV PNSMTRFERS AAYGSFSLPG RQQLGPTHSF SFGMNQPGLA  660
NLAMAGLGPG QPKMPVMSVH PYLAQQRPMS EMGFMLPKGE PKMEPMSEPS LNLSNNPSVY  720
QQFMNRLPLG PQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-36310585878Probable WRKY transcription factor 4
1wj2_A1e-36310585878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002529203.10.0PREDICTED: probable WRKY transcription factor 2 isoform X1
RefseqXP_015580904.10.0PREDICTED: probable WRKY transcription factor 2 isoform X1
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLB9ST840.0B9ST84_RICCO; Putative uncharacterized protein
STRINGPOPTR_0001s47670.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95243443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY DNA-binding protein 2